Би 2 несушка: Инкубаторы для яиц Несушка БИ 2 на 36, 77 и 104 штуки

Содержание

Инкубатор несушка: инструкция, отзывы, видеообзоры (+фото)

В разведении птиц многие предпочитают использовать инкубационный, а не естественный способ. Приобретение техники всегда вызывает множество вопросов, особенно у начинающих заводчиков. Существует множество дорогих и дешевых моделей. Они отличаются маркой производства, вместительностью, сложностью управления, габаритами.

Большинство фермеров предпочитает останавливаться на простых вариантах. В число самых востребованных бытовых инкубаторов входят устройства Несушка Би-1 и Несушка Би-2.

Содержание статьи

Инкубатор Несушка Би-1 на 36 и 72 яиц

Несушка Би-1 – оптимальный вариант для обучения инкубации. Его удобно применять дома, в небольших сельских хозяйствах, на мини-фермах. Модели на 36 и 72 яйца соответствуют потребностям разведения для семейного пропитания.

Несушка Би-1 – оптимальный вариант для обучения инкубации.

Технические характеристики «Несушки» Би-1

Би-1 имеет оптимальную конструкцию в условиях максимальной компактности. Размеры устройства составляют всего 67х34х31 см. Корпус из легкого пенополистерола весит 1,8 кг, что позволяет без труда производить транспортировку.

Вместительность 36 и 72 яйца традиционно указывается для кур. С помощью такого инкубатора также можно выводить разные виды перепелов, уток, фазанов, голубей и гусей. Для этого потребуется установить специальную решетку.

[adsp-pro-4]

Инкубатор питается от электросети с диапазоном 198-242В. Максимальная мощность составляет 28Вт. Аппарат способен выдавать температуру от 33 до 45С, погрешность поддержания тепла составляет не более 0.2С. Температура окружающей среды для бесперебойной работы должна быть в пределах 18-28С.

Модификации

Разные модификации Несушки Би-1 имеют свои функции.

Существуют разные варианты исполнения Несушки Би-1. Кроме количества вмещаемых яиц модификации отличаются терморегулятором и способом поворота яиц.

Терморегулятор может быть:

  • аналоговый – настройка температуры поворотом ручки по часовой (увеличение) или против часовой (уменьшение) стрелки, необходимо следить за нагревом самостоятельно, подправлять показатели;
  • цифровой – настройка происходит с помощью кнопок и информационного табло, поддержание температуры происходит стабильно в течение длительного времени без корректировки.

Поворот яиц может происходить автоматически или производиться вручную пользователем. Автоматический вариант намного удобнее, поскольку о данной операции легко забыть, но аппарат все сделает сам. Альтернативой автоповороту служит возможность ставить дополнительные места для яиц.

Автоматические модификации также способны сами держать требуемый уровень влажности. Механическое управление лишает птицевода такой функции. В современных выпусках устанавливается сигнализация отклонения температур от нормы.

Стоит обратить внимание, что Би-1 на любое количество яиц в определенных модификациях может работать от внешнего аккумулятора до 20 часов. Автономное питание приобретается отдельно от самого инкубатора.

В инкубаторе установлен аналоговый или цифровой терморегулятор.

Из чего состоит инкубатор

Прибор представляет собой корпус с крышкой, индикаторами, ручками или кнопками настройки, смотровыми окнами. К нему присоединяется сетевой шнур. Внутри установлены нагревательные элементы, термодатчики и регуляторы, решетки для яиц, опционально механизм вращения.

Также внизу корпуса имеется 2 углубления для поддержания влажности – в них наливается вода. В комплекте может присутствовать сетка, которая ставится на держатели яиц.

Как пользоваться Несушкой Би-1

Перед началом эксплуатации проводится внешний осмотр целостности, проверяется комплектация. Решетка устанавливается гладкой стороной вверх на дно корпуса. Если присутствует автоповорот – его устройство присоединяется к корпусу по инструкции. Далее Несушку Би-1 подключают к электросети (оптимально 220В).

Яйца закладывают после нагрева инкубатора.

После того как решетка передвинулась от одной стенки к другой, терморегулятор приводят к показателю средней температуры на 20-30 минут. При достижении рабочего нагрева индикатор начнет мигать. Далее инкубатор можно отключить от 220В и перевести в режим аккумулятора 12В с помощью клемм.

На следующем этапе закладывают яйца. Предварительно заливается теплая прокипяченная вода, выставляется 37,7С. Отбирают гладкие свежие яйца среднего размера с матовой скорлупой. Желательно проверить их овоскопом и протереть перекисью водорода.

На яйцах ставят отметки сторон (например, А и Б или 1 и 2) для контроля переворачивания, кладут их на сетку. Крышку закрывают, выставляют температуру 38С. В середине процесса поднимают тепло до 38,5С. За 2-3 дня до выведения яйца перестают переворачивать, опрыскивают скорлупу водой и ставят терморегулятор на 37,5С. В среднем цикл инкубации занимает от 19 до 21 суток.

Важно. До закладки яйца не должны храниться дольше 10 дней. Оптимальная температура в период выжидания – 10С тепла.

Отзывы об инкубаторе

Анна. Хороший инкубатор по демократичной цене. Пользуюсь уже 3 года. У знакомой такой же постоянно сбивает температуру, у меня нареканий к своему нет. Видимо, возможен брак производства.

Фермеры отмечают невысокую стоимость инкубатора Несушка Би-1.

Александр. У меня был Би-1 несколько лет, но я его продал. Брал, чтобы учиться инкубации, теперь решил сделать более совершенную модель сам. В принципе, Несушка не плоха. От перебоев энергии спасал аккумулятор. Мне не нравился корпус – сам материал плохо поддается дезинфекции и прогрев бывает неравномерный. Убрал проблему прогрева отключением автоматического поворота и переворотом вручную от краев к центру.

[adsp-pro-5]

Инкубатор Несушка Би-2 на 77 и 104 яиц

Несушка Би-2 является аналогом Би-1 по назначению. Данный инкубатор также ориентирован на куриные яйца, но с установкой сеток может быть использован и для прочих видов (гуси, перепела, утки и т.д.). Также решетки можно использовать для увеличения вместимости.

Корпус сделан из специального пластика, который отличается прочностью и легкостью. Технические характеристики и габариты несколько отличаются от Би-1.

Несушка Би-2 вмещает большее количество яиц.

Технические характеристики Несушки Би-2

Инкубатор данной модели имеет размеры 60 на 30 на 65 см. Ее вес от вместимости яиц колеблется в пределах 2-6 кг. Прибор питается от электричества. Допустимое напряжение сети – 220В с частотой 50Гц. Допустимая погрешность напряжения – не более 10% от нормы.

Агрегат потребляет 20Вт. При такой мощности он способен поддерживать температуру от 33 до 43С с точностью до ± 0,2С. Внутри инкубатора допустимый разброс температуры от углов к центру составляет не более 1С.

Плюсом Несушки Би-2 является наличие усиленной защиты от ударов током (2 класс) и проникновения лишней воды (IPX4).

Инкубатор данной модели имеет размеры 60 на 30 на 65 см.

Модификации

Би-2 представлен в модификациях с цифровой и аналоговой терморегуляцией. Автоматический регулятор сам стабилизирует температуру внутри инкубатора периодическим включением и отключением нагревательного элемента. Аналоговый вариант предполагает корректировку вручную специальным реле.

Переворачивание яиц может происходить в разных сборках разным методом:

  1. вручную;
  2. автоматически – ячейка переворачивается по настроенному таймеру без вмешательства человека с помощью устройства автоматического поворота;
  3. механически – сетки переворачиваются специальным рычагом.

Питание может быть предложено либо только от сети, либо от сети и аккумулятора 12В. Аккумуляторные виды бывают с автоматическим и ручным переключением источника электричества.

Переворачивание в Несушке Би-2 происходит тремя способами.

Из чего состоит инкубатор

Основные составные части инкубатора Несушка Би-2 это корпус с нагревательным элементом внутри и крышкой сверху. На нем имеется смотровое окошко из прозрачного стекла, регулятор температуры, лампочки или маленькое электронное табло для сигналов активности.

[adsp-pro-7]

Внутри установлены решетки и сетки, устройство поворота (опционально). Для питания прилагается сетевой шнур.

Как пользоваться Несушкой Би-2

Процесс использования полностью соответствует Би-1. Подготовленные яйца укладывают в предварительно нагретый инкубатор, выставляют нужную температуру и режим работы. Крышку закрывают и оставляют на 19-21 день с регулярным контролем. В автоматическом режиме решетка должна двигаться плавно с переворотами раз в час.

Принцип действия у Несушки Би-1 и Би-2 одинаков.

Важно. Нельзя устанавливать устройство на пол. Для правильной работы необходима ровная внешняя температура воздуха без перепадов. Оптимальным местом для инкубатора станет небольшой стол или тумбочка.

Отзывы от фермеров

Юрий. Я начинающий птицефермер. Би-2 – мой первый инкубатор. При первом использовании вылупилось всего 37 яиц из 69. Вторая проба была более удачной. Пляски вокруг прибора были постоянно. Может дело в моей неопытности, но пока работать с ним сложно.

Петр. Не в восторге. Нагреватель из металла и перегрева не избежать. А если уронить при перевозке, то корпус разлетится в хлам. Инкубация была неудачна, решетка на яйца наезжала. Хотя знаю людей кто пользуется с успехом и доволен. Дело вкуса и умения приспосабливаться. Как по мне, для обучения нормально, для постоянного разведения не пойдет.

Предлагаем посмотреть видеоотзыв от фермера об инкубаторе для вывода птенцов Несушка Би-1 (Би-2).

Инкубатор Несушка БИ 2 на 104 Цифровой терморегулятор (автомат), 220/12В

Наименование: Инкубатор «Несушка БИ 2» на 104 яйца куриных, автоматический поворот, цифровой терморегулятор, 220/12В

Назначение: вывод цыплят из яиц куриц в домашних условиях. Дополнительно возможно использовать для вывода гусиных, утиных, индюшиных, перепелиных яиц

Характеристики:

Вместимость (куриных яиц среднего размера), шт. 104

Автоматический поворот яиц

Потребляемая мощность от 220В/12В: 60/65 Вт

Время работы от аккумулятора: 10 час

При выключение электроэнергии переключается на работу от аккумулятора, и наоборот

Напряжение сети, В 220

Терморегулятор цифровой поддерживает установленную температуру и направляет механизм поворота яиц

Точность поддерживания температуры: ± 0,1°С

Пределы регулирования температуры: 33 — 45°С

Разброс температуры в инкубаторе: не более 1°С

Прозрачное окошко для контроля процесса

Габариты (длина/ширина/высота): 810х600х310 мм

Масса нетто, не более, кг 3,2

Материал корпуса: пенопласт

Подсветка: есть. Внутри короба инкубатора установлен яркий светодиод, который потребляет минимальное количество электроэнергии, но при этом дает возможность наблюдать за процессом через прозрачное смотровое окно

Страна производитель: Россия

Гарантия: 1 год

Производитель: ООО «Завод Электробытовых товаров» 630049 г. Новосибирск, ул. Дуси Ковальчук 179/2

 

Комплектация инкубатора Несушка БИ 2 на 104 яиц куриных

Инкубатор бытовой — 1 единица

Руководство по эксплуатации — 1 единица

Автоматический механизм переворота яиц — 1 шт

 

Инкубатор Несушка Би 2 — это аппарат, рассчитанный на 104 куриных, утиных яйца, 50 гусиных и 143 перепелиных. Если Вы искали инкубатор Несушка БИ 2 (м) на 77 яиц, то вам сюда: инкубатор на 77 яиц

 

Инкубатор Несушка БИ 2 104 220/12В — это российский аппарат

Бытовой инкубатор Несушка би-2: отзывы, видео инструкция

Инкубатор бытовой би-2 Несушка– это одно из самых популярных приспособлений для занятия птицеводством в домашних условиях. Его производит отечественная компания из Новосибирска «Полимер-Продукт». Среди профессиональных птицеводов она более известна как «Несушка». Используется для выведения, а также инкубации множества видов домашних птиц. Инструкция к бытовому инкубатору Несушка би-2 гласит, что он предназначен не только для разведения кур, перепелок, уток, гусей и индюков, но и голубей, попугаев, лебедей.

Инкубатор Несушка би-2

Модификации

Инкубатор Несушка имеет разные модификации. Они различаются в зависимости от своих функциональных особенностей и дополнительной комплектации устройства. Бывают 4 вида переворота:

  • Механический;
  • Автоматический;
  • В точно назначенное время;
  • Через равные промежутки времени.

Можно подобрать себе инкубатор би-2 Несушка с различными типами термометра:

  • Аналоговый;
  • Цифровой.

Существуют еще одно различие между модификациями Несушки:

  • Наличие резервного питания. В этом случае следуя указаниям инструкции можно подключить аппарат к аккумулятору от автомобиля;
  • Отсутствие возможности подключения аккумулятора для резервного питания.

Во время покупки инкубатора, даже через Интернет, можно легко отличить модель устройства, которая обладает возможностью подключения дополнительного питания. Чаще всего на эту особенность указывают обозначения в названии и характеристика напряжения питания 220 (12) В, что означает возможность питания аппарата от 12-вольтового аккумулятора.

Инкубатор Несушка би-2

Если происходит отключение электричество во время работы инкубатора, то в течение первых 2 часов его можно просто накрыть теплым одеялом и не подключать аккумулятор, как показано на фото. Главное перекрыть выход теплого воздуха наружу, закрывая отверстия для вентиляции. Чем дольше в аппарате будет сохранять тепло, тем больше времени он сможет продержать без энергии.

Технические характеристики

Самые лучшие отзывы среди птицеводов получили инкубаторы с возможностью автоматического переворота и с цифровым термометром. Эти Несушки минимизируют трудовые расходы и снижают количество затраченного времени, которое необходимо для высокого процента выводимости. В инструкции подробно расписан процесс установки и налаживания всех необходимых функций. Цена многофункционального бытового инкубатора немного выше от обычного.

Большим плюсом Несушки являются ее небольшие размеры и достаточно большая вместительность. Аппарат би-2 может уместить 96 эталонных куриных яиц, как видно на фото. В любой комплектации инкубатор бытовой Несушка весит не более 6 кг.

Регулировать температуры в инкубаторе можно в диапазоне 33-43 градуса. Если в устройстве установлен аналоговый термометр, тогда точность температуры достигается до 0,2 градуса. При наличии цифрового терморегулятора точность температуры можно установить вплоть до 0,1 градуса. Но оба вида терморегулятора имеют отличные отзывы у птицеводов и хорошо держат температуру.

Корпус аппарата имеет высокие теплоотражающие и теплоизоляционные показатели, которые достигаются благодаря тому, что его стенки изготовлены из пенополистерола. Внутри находятся специальные решетки, для держания яиц. Самые новые модификации Несушки укомплектованы цифровым блоком управления. Им очень легко пользоваться. В инструкции детально описано, как его настроить, чтобы достичь необходимой температуры.

Монтировать инкубатор необходимо в помещении, в котором температура не опускается ниже 15 градусов и не бывает выше 35 градусов. Установка Несушки на пол не допускается. Запрещено ставить аппарат под прямыми солнечными лучами. В инструкции указано, что обязательно нужно обеспечить для инкубатора хороший поток воздуха. При необходимости, прочистите отверстия для вентиляции от стружки из пенопласта.

Первый раз включите аппарат на 2-3 часа, не загружая в него яйца. Детально изучите инструкцию изделия и проведите настройку всех его функций. Процесс калибровки терморегулятора производите, используя медицинский градусник, как показано на видео.

На дне камеры расположены небольшие углубления (15 штук), которые заполняются водой. Они необходимы для поддержания необходимого процента влажности в инкубаторе. В инструкции к Несушке детально описано, как можно определить влажность камеры.

После каждого использования необходимо тщательно промывать все съемные элементы и очистить саму камеру. Чистящие средства должны быть мягкими и не содержать абразивные частички, чтобы не повредить стенки. После чистки просушите аппарат и поставьте все съемные детали на место.

Производитель гарантирует минимум десять лет работы инкубатора. Но по истечению этого срока им можно и дальше пользоваться, при условии, что нет никаких технических неисправностей и повреждений. В течение года после покупки возможна бесплатная замена неисправных деталей или ремонт по гарантии.

Подведем итоги

Бытовой инкубатор Несушка би-2 завоевал большую популярность среди птицеводов России. Главное его преимущество – это легкость в управлении, а детальное описание всех его функций находиться в инструкции. Несушка компактная, вместительная и достаточно недорогая. Она отлично подойдет как для начинающих, так и для опытных птицеводов.

(PDF) Влияние пород, положения клеток, загона и лет на продуктивность несушек четырех несушек в южной Гвинее, регион Саванна, Нигерия

58

South As. J. Biol. Sci. 2 (2): 50 — 62 Gwaza et al

Порода варьировалась в зависимости от их приспособленности в регионе. Любая из этих пород подходит для этого региона. Улучшение системы управления

приведет к улучшению несушек пород.

Воздействие загона

Существенное влияние яйцекладки в загон указывает на то, что в загонах

(вентиляция, продолжительность светового дня, температура, влажность, потребление корма) наблюдались различия в условиях окружающей среды, на которые повлияло

девичник лежал. Авони и др.

18

также сообщили о значительном влиянии птичников на производство кур в

Белом Леггорне. Различия в условиях окружающей среды в загонах, которые, соответственно, повлияли на девичников-несушек

, могли возникнуть из-за различий в конструкции загонов.В загоне L

1

этаж был поднят на

над уровнем земли. Клетки стояли вплотную к стене. Хотя запас окна на уровне пола был низким,

низкий запас крыши на уровне пола позволит быстро излучать тепло в загон. Положение клетки может препятствовать свободному выходу теплого воздуха из загона. Это вызовет необходимость накопления тепла, что сделает

одышки неэффективными, что приведет к тепловому стрессу у птиц.Об этом наблюдении также сообщили Олуйеми

и Робертс

5

, Вебстер и Уилсон

19

.

В загоне L

2

уровень пола был ниже уровня земли. Запас окна на уровне пола был высоким,

среда ручки была плохо вентилируемой и увеличивало накопление тепла, тем самым делая рассеивание тепла

за счет дыхания неэффективным. Птицы в этом загоне будут подвергаться тепловому стрессу и воздействию на курицу, как наблюдалось

.В загоне L

3

пол находился на уровне земли. Запас окна на уровне пола был низким. Вентиляция в

в этом загоне была лучше, чем в других. Пен (L

3

) также был ближе к реке, так что прохладный воздух из реки

еще больше уменьшал тепло в загоне, когда он пересекал реку. Следовательно, птицы в этом загоне будут терять тепло тела

быстрее из-за одышки, будут меньше подвергаться тепловому стрессу, так что потребление корма и яйценоскость будут меньше затронуты.

Плотность населения на загон слоев также имеет значение в этом исследовании. Carew et al.

20

также

сообщил, что по мере увеличения плотности на клетку (поголовье загона) яйценоскость и эффективность использования корма

снизились. Эффект среды, а не популяции был продемонстрирован в

pen L

2

и L

3

. Pen L

2

с уровнем пола ниже уровня земли и широким краем окна на уровне пола имел более

экологического (температурного) стресса, был менее продуктивным.Ручка L

3

с меньшей температурой окружающей среды

стресс был наиболее продуктивным. Awoniyi

18

, также сообщил о существенных различиях (p˃0,05) в продуктивности куриных яиц

между птичниками у олимпийской черной несушки. Значительно более высокая разница в яйцеклетках

, зафиксированных в загоне L

1

(2 клетки), чем в загоне L

2

(3 клетки), могла быть обусловлена ​​плохими условиями содержания в загоне

из L

2

.Ручка L

2

при высоком экологическом стрессе была менее продуктивной.

Связывая результаты этого исследования с более ранними отчетами для лучшего будущего производства, важно отметить

, что среда, в которой находятся цыплята-несушки, частично определяется руководством

, которое определяет дизайн птичников. Маловероятно, что птицы будут работать удовлетворительно, если корпус

не подходит. На самом деле жилье должно соответствовать климатическим условиям региона.

Что нужно знать, чтобы подготовить кур к откладыванию яиц

Хотя не обязательно «разговаривать» с курицей, когда они достигают половой зрелости, лучше подготовить их, когда они достигнут стадии яйцекладки в своей жизни. Это включает в себя как экологические, так и диетические меры, чтобы дать вашим курицам необходимый старт в качестве продуктивного несушки.

Корм, содержание и гигиена являются ключевыми факторами при уходе за молодыми курицами. Вот что вам нужно знать, чтобы начать их использовать, чтобы извлечь пользу из свежих яиц каждый день.

«Мы называем это« кондиционированием »цыплят, — сказала д-р Анн Лихтенвалнер, директор ветеринарной диагностической лаборатории Университета штата Мэн. «Животное похоже на подростка, которое готовится к размножению, поэтому им нужно научиться некоторым правилам поведения, чтобы добиться успеха».

Правильный корм

По словам Лихтенвальнера, крайне важно, чтобы вся домашняя птица и домашний скот получали корма, соответствующие возрасту и стадию выращивания. Например, дойных коров следует кормить кормом, основанным на определенных белках, углеводах и клетчатке, необходимых для максимальной молочной продуктивности, а также для поддержания здоровья коровы.

Куры-несушки обычно начинают откладывать яйца в возрасте от 14 до 15 недель, но время менять корм приходится в возрасте от 10 до 11 недель.

«Когда курица начинает откладывать яйца, внезапно ее организм должен производить тонну кальция», — сказал Лихтенвальнер. «Это происходит во время полового созревания и когда они достигают большей части своего взрослого размера».

В течение первых трех месяцев своей жизни молодь куриц должна была питаться «гроверским» кормом, состав которого разработан с учетом соотношения протеина, необходимого им для оптимального роста.За месяц до того, как они вступят в стадию откладывания яиц в своей жизни, пора начать постепенно вводить их в рацион, богатый кальцием.

«Вы можете делать это медленно», — сказал Лихтенвалнер. «Вы можете начать добавлять корм для несушек в корм для несушек и продолжать уменьшать количество корма для несушек, пока куры не достигнут 17-недельного возраста и не будут получать 100-процентный корм для несушек».

Окружающая среда, благоприятная для укладки

По мере того, как куры начинают созревать в несушки — но до начала яйценоскости — вы должны убедиться, что их курятник является привлекательным местом для откладывания яиц.

По словам Лихтенвальнера, это означает создание в курятнике немного изолированного и тихого места с хорошими, чистыми, уютными постельными принадлежностями. Один из лучших способов сделать это — построить и установить достаточное количество скворечников из расчета четыре птицы на каждый ящик. С небольшими стадами вы можете установить по одному ящику для каждой курицы. В ящиках всегда должна быть чистая подстилка, например, сосновая стружка или солома.

«Вашим птицам не нужно находиться в скворечниках очень долго, может быть, час или около того каждый день», — сказал Лихтенвальнер.«Но вы хотите, чтобы они знали, что это то место, куда они могут пойти и не беспокоиться».

Курам, кажется, особенно нравятся скворечники с каким-то покрытием над ними, которое может сделать гнездовую часть темнее, чем остальная часть курятника.

После того, как куры начнут нести яйцеклетку, нужно проверять гнездовые ящики не реже одного раза в день и собирать все яйца. После удаления яиц Лихтенвальнер рекомендует вычерпать и избавиться от куриного помета, скопившегося в скворечнике.

«Я люблю подбрасывать пригоршню свежей стружки после удаления навоза», — сказала она. «Мне особенно нравится сосновая стружка, потому что она обладает противомикробными свойствами, она чистая и легко заменяется».

Альтернатива — катастрофа

Если куры не привыкают к скворечникам до того, как начнут откладывать яйца, они могут откладывать яйца, где бы они ни находились в данный момент — на полу курятника, на улице под кустами, если они находятся на свободном выгуле, или даже на сельскохозяйственном оборудовании. .

Это может быть в лучшем случае раздражающим, учитывая сложность поиска и сбора яиц, и в худшем случае катастрофическим, особенно для яиц, отложенных на полу курятника на открытом воздухе.

По словам Лихтенвальнера, курица может прийти, заметить это одинокое яйцо и решить клюнуть и разбить его. Это может быстро перерасти в постоянное клевание яиц несколькими птицами в стае.

«Это может быть катастрофой», — сказал Лихтенвальнер. «Вы можете получить непродуктивное стадо.”

К счастью, шаги по обеспечению счастливых, здоровых и продуктивных несушек не так уж и сложны. Обращая внимание на их потребности в стадии роста и потратив некоторое время на подготовку курятника, вы значительно повысите свои шансы на годы получения свежих яиц от вашего стада.

ПТИЦА |

Доступен заказ птицы на подворье. Щелкните ссылку ниже, чтобы загрузить форму заказа. Обратите внимание: дата доставки 10 июня уже распродана.

NB: Птиц необходимо забрать в Блэкстоке в подтвержденный день вывоза — Извините, перенос птиц на следующий день или позже не допускается.

Для справки: В Онтарио в стаде несушек на заднем дворе может быть до 99 кур без квоты на закупку. Несортированные яйца можно продавать только у ворот фермы; Сортированные яйца (через лицензированную сортировочную станцию) можно продавать где угодно, даже небольшими стайками.

КОРМЛЕНИЕ КУРИЦ И ИНДЕЙКИ:

У нас есть

Shur-Gain’s собственное «Small Flock» и / или «Homestead» линейки кормов для курицы и индейки, которые имеют крошащуюся однородную текстуру (в мешках по 25 кг или навалом по 2 тонны. доставляется на ферму) в качестве рациона для кормления вашего стада.

Вот брошюра

компании Shur-Gain о программе кормления мелкими стадами птицы, которая предоставит вам много информации об их программе кормления от суточных до рыночных.

Любые вопросы, которые могут у вас возникнуть по поводу выращивания стада на заднем дворе, можно направить любому персоналу Wright’s Feeds ‘N Needs — мы будем рады помочь.

Не стесняйтесь обращаться к нам по электронной почте [email protected], чтобы получить актуальную информацию о ценах или задать нам какие-либо вопросы.

ОРГАНИЧЕСКИЕ КОРМА ДЛЯ КУР И МЯСНЫХ ПТИЦ:

Если вы планируете попробовать органические корма для своего поголовья на заднем дворе, Wright’s Feeds ‘N нуждается в подстилке круглый год в органической несушке, а в период выращивания цыплят — в органической закваске для цыплят и органической птицефабрике.

* Предупредите нас, если вы заинтересованы в использовании всех органических кормов для своей мясной птицы или кур-несушек — мы получаем эти продукты только два раза в месяц, и нам нужно 2-3 недели для заказа нашего поставщика. заказать / доставить. Пожалуйста, дайте нам достаточно времени для выполнения ваших заказов на органические корма.

Формирование яиц и качество яичной скорлупы в слоях — понимание факторов, которые могут повлиять на качество скорлупы, жизненно важно для производства яиц с максимально возможным качеством.

Биозащита для малых птицефабрик — Щелкните, чтобы получить информацию, чтобы защитить свое стадо.

Качество воды для птицеводства – Nutrifax — Безопасное и достаточное водоснабжение необходимо для эффективного птицеводства.

REMINDE R : Новые производители домашней птицы должны будут зарегистрироваться как гребцы Family Food G в Онтарио.

Как лицензированный брокер / дилер для цыплят Онтарио, , мы можем получить этот номер от вашего имени после того, как вы разместите заказ на цыплят, предоставив нам свою контактную информацию и место, где будут выращиваться ваши цыплята.

Если вы впервые имеете собственное стадо на заднем дворе, мы подготовили загружаемый документ,

КОНТРОЛЬНЫЙ СПИСОК ЦИПЕНТОВ , который предоставит вам все подробности, чтобы подготовить своих цыплят и как ухаживать за ними по мере их выращивания. рыночный вес.

Стадия развития зародыша гуся при кладке в зависимости от генотипа, возраста стада и срока яйцекладки., Poultry Science

Развитие эмбриона и качество цыплят зависят от генотипа родителей, возраста, питания, окружающей среды и содержания стада.Целью исследования было определить, влияют ли генотип, возраст гуся или яиц, отложенных в начале яйцекладки, по сравнению с яйцами, отложенными в конце репродукции, на стадию эмбриона при кладке. Было проведено три эксперимента. Для сравнения генотипов (эксперимент 1) было собрано 150 яиц от трехлетних гусей коммерческой линии Белая Колуда (WK) и от двух пород, участвующих в программе сохранения генетических ресурсов, Заторской (За) и Билгорай (Би). Сравнение возраста (эксперимент 2) было проведено с 200 яйцами, собранными от 1-, 2-, 3- и 4-летних гусей WK.Для сравнения периодов яйцекладки (эксперимент 3) 150 яиц WK было собрано в первую неделю марта и 100 — во второй половине июня. Яйца хранили в течение 72 часов при 16 ° C, используя процедуры Eyal-Giladi и Kochav (EGK, римские цифры) и Hamburger and Hamilton (HH, арабские цифры). Эксперимент 1. Различия между отдельными породами были очевидны для эмбрионов EGK стадии X, составляющих 42,4, 33,3 и 38,7% яиц, исследованных из WK, Bi и Za, соответственно. Для всех пород вместе 38,8% эмбрионов находились на стадии X, но в следующем порядке в WK была стадия XI (18.2%), а у гусей из генетического заповедника — XIII стадия (Bi — 33,3; Za — 29,0%). Эксперимент 2: в яйцах 1-, 2- и 3-летних гусей WK большинство эмбрионов (38,7, 32,4 и 42,2% соответственно) находились на стадии X. Напротив, у 4-летних гусей. эмбрионы находились на стадии XI (36,1%). Эксперимент 3: В яйцах, собранных в марте и июне, большинство эмбрионов находились на стадии X (33,7% и 43,6% соответственно). Кроме того, более продвинутые стадии развития (XI-XIII) были сходными в обоих периодах.Однако эмбрионы на стадии 2 HH наблюдались только в яйцах, собранных в конце сезона яйцекладки. Интересно, что более ранние стадии (VI-IX) наблюдались исключительно в мартовских яйцах.

中文 翻译 :


产卵 时 鹅 胚胎 发育 的 阶段 取决于 基因型 , 成群 年龄 和 产蛋 期。

胚胎 发育 和 雏鸡 质量 受 父母 基因型 , , 营养 环境 和 鸡群 管理 的 影响。 研究 的 目的 是 确定 在 开始 时 产蛋 的 鹅 的 基因型 , 年龄 时 蛋的 是否 会 影响 胚胎 的 产卵 阶段 了 三个 实验。 为了 比较 基因型 (实验 1) , 从 3 岁 的Zatorska (Za) 和 Bilgoraj (Bi) 收集 ​​了 150 个 卵。 使用 从 1 岁 , 2 岁 , 3 岁 和 4 岁 的 WK 鹅 收集 的 200 个 卵 进行 年龄 比较 (实验 2)。 为了 比较 产蛋 期 (实验 3) , 在 3 月 的 第一 周 收集 了 150 个 WK 卵 , 在 6 月 下半月 收集 了 100 WK 卵。 鸡蛋 在 16 ° C 下 保存 72 小时 , 使用 Eyal-Giladi 和 Kochav (EGK , 罗马数字) 以及 Гамбургер 和 Гамильтон (HH , 阿拉伯数字) 过程 进行 上演。 实验 1 : 在 从 WK , Bi 和 Za 的 的 卵 中 , 分别 具有 42.4 33.3 % 38.7 的 EGK 胚胎 明显 的 个体 差异。 在 的 38.8 的 胚胎 处于 X , 但 在下 一个 WK 有 XI (18.2 %遗传 储备 的 鹅 则 处于 XIII 期 (Bi-33.3 ; Za-29.0)。 %)。 实验 2 : 在 1 岁 , 2 岁 和 3 的 的 WK 鹅卵 中 , 大多数 胚胎 (分别 为 38.7 % , 32.4 %和 42.2 %) 处于 X 期。 相比之下 , 在 4 岁 的 鹅 中 胚胎 处于 XI 期 (36.1 %)。 实验 3 : 在 3 月 和 6 月 的 卵 中 , 大多数 胚胎 处于 X 期 (分别为 33.7 % 和 43.6)。 此外 , 在 两个 时期 中 , 更 高级 的 发展 阶段 (XI-13) 相似。 但是 , 的有趣 的 是 , 仅 在 3 月 收集 的 卵 中 观察 到 了 早期 阶段 (VI-IX)。

Динамический профиль экспрессии, регуляторный механизм и корреляция с характеристиками откладки яиц семейства генов ACSF у кур (Gallus gallus)

Семейство ACSF играет решающую роль в метаболизме липидов у млекопитающих 5 .Однако, насколько нам известно, до сих пор не поступало никакой информации о семействе куриных ACSF. В настоящем исследовании мы впервые продемонстрировали существование ACSF1 в геноме курицы, в соответствии с консенсусной консервативной геномной синтенией AACS между курицами и другими видами. Сравнение множественных нуклеотидных последовательностей у разных видов показало, что ACSF1 и ACSF2 имели относительно высокую идентичность, тогда как ACSF3 продемонстрировали относительно низкую идентичность.Аминокислотный анализ выявил три высококонсервативных мотива в ACSF1 курицы — мотив I: YSSGTTGAPK, мотив II: HGDYCKINPKTGGVVMLGRSDGTLNPNGVRFGSSEIY и мотив III: PYTLNGKKVE; пять в ACSF2 курицы, мотив I: FTSGTTGSPK, мотив II: TGDIATLDEHGYCRIIGRCKDMIIRGGENIYPAEIE, мотив III: YGTTE, мотив IV: APLYH и мотив V: PLTVSGKIQK; и три в ACSF3, мотив I: YTSGTTGRPK, мотив II: YGMTE и мотив III: LPLHH — были идентифицированы путем сравнения с человеческими ACSF1, ACSF2 и ACSF3, соответственно. Консервативные мотивы, вероятно, выполняют важные функции в связывании субстрата и / или катализе 5 .Анализ функционального домена белка ACSF курицы идентифицировал консервативный сайт связывания AMP, что согласуется с представлением о том, что ACS точно регулируются на уровне транскрипции посредством трансактивации, управляемой циклическим AMP (cAMP) 21 . Многочисленные прокариотические и эукариотические ферменты, которые, по-видимому, действуют посредством АТФ-зависимого ковалентного связывания АМФ с их субстратом, имеют общие области сходства последовательностей, такие как Co-A-лигаза длинноцепочечных жирных кислот и ACS 22 . Примечательно, что эти консервативные мотивы ACSF расположены в соответствующих им областях связывания AMP.Эти результаты предполагают, что ACSF1 и ACSF2 могут иметь сходную эволюционную историю и функции, в то время как ACSF3 более дивергентен, который, возможно, получил другую новую функцию из-за дупликаций всего генома 23 . Более того, консервативные остатки или домены могут быть важны для связывания субстрата 24 .

Анализ модели временной и пространственной экспрессии ACSF1 , ACSF2 и ACSF3 показал, что они высоко экспрессируются в печени и почках кур-несушек, что согласуется с предыдущими данными об уровне экспрессии мРНК ACSF2 у гуся 6 и уровень белка ACSF3 у мышей 25 .Более того, у курицы почки и печень — это органы, в которых липиды эффективно метаболизируются, особенно печень. Анализ экспрессии генов ACSF в печени на разных стадиях показал, что ACSF1 и ACSF2 показали более высокую экспрессию в куриной печени в период пика яйцекладки (30 недель), чем в ранней (20 недель) и поздней яйцекладке. периодов (возрастом 50 недель), тогда как у ACSF3 изменений не наблюдалось. Синтез липидов и метаболизм резко увеличились с раннего до пикового периода яйцекладки, чтобы синтезировать питательные вещества, необходимые во время эмбрионального развития для образования яичного желтка.Таким образом, мы предположили, что ACSFs , вероятно, участвуют в метаболизме липидов птиц, и что ACSF1 и ACSF2 играют в этом доминирующую роль, а ACSF3 нет. Необходимы дальнейшие исследования, посвященные роли гена семейства ACSF курицы в липидном метаболизме почек.

Эстроген играет жизненно важную роль в половом созревании и развитии репродуктивной активности самок, а также может регулировать липидный обмен кур в период яйцекладки.Печень, как орган, имеющий чрезвычайно важное значение в метаболизме липидов и нацеленный на эстроген, была использована для изучения воздействия эстрогена на ACSF, что касается их высокой экспрессии в печени кур-несушек. Мы оптимизировали дозы эстрогена, используемые для исследований in vivo, и in vitro, , в соответствии с предыдущими отчетами 26,27,28,29 , нашими предварительными экспериментами и связанной с ними работой 30 . Наши результаты показали, что ACSF1 и ACSF2 положительно и отрицательно регулируются дозозависимым образом эстрогеном, соответственно, но не было обнаружено никаких изменений в ACSF3 .В то же время при обработке первичных гепатоцитов цыплят различными концентрациями эстрогена было обнаружено постепенное увеличение мРНК ACSF1 и постепенное уменьшение мРНК ACSF2 , но не было изменений в мРНК ACSF3 . По мере полового созревания кур концентрация эстрогена в плазме постепенно повышается, причем заметный рост наблюдается, когда куры находятся в возрасте от 16 до 20 недель, и остается высокой в ​​течение следующих нескольких недель для яйценоскости, а затем снижается до тех пор, пока не прекращается яйцекладка 31 .Более высокая экспрессия ACSF1 в обработанных эстрогенами печени и клетках соответствовала таковой в период пика яйцекладки по сравнению с таковой в ранний или поздний период яйцекладки, в то время как экспрессия ACSF3 также не изменилась и ACSF2 показал более низкую экспрессию в обработанных эстрогеном клетках и печени, но более высокую экспрессию в период откладки пика. С наступлением периода яйценоскости некоторые гормоны, помимо эстрогена, такие как фолликулостимулирующий гормон (ФСГ) и лютеинизирующий гормон (ЛГ), физиологически увеличились в соответствии с физиологическими процессами с большим отрывом.Эти другие гормоны, а не эстроген, могут объяснить более высокую экспрессию ACSF2 в возрасте 30 недель, но более низкую экспрессию после лечения эстрогеном.

Сообщалось, что эстроген выполняет широкий спектр функций в регулировании липогенных генов с сайтами ERE или AP1 путем прямого или косвенного связывания с ER, включая ядерные рецепторы (ERα, ERβ) и мембранные рецепторы (GPR30). Чтобы исследовать молекулярный регуляторный механизм эстрогена на ACSF1 и ACSF2 , был проведен дальнейший анализ их промоторов, который показал, что несколько неклассических сайтов ERE присутствовали в ACSF1 , а эксклюзивный сайт AP1 присутствовал в ACSF2. .Селективные антагонисты рецепторов эстрогена, такие как MPP, TAM и ICI, представляют собой другой подход к изучению функций рецепторов помимо нокаута гена 32,33,34 . При связывании с антагонистом ER не взаимодействует с коактиваторами и, в свою очередь, не активирует транскрипцию 13 . Поскольку MPP является высокоселективным в отношении ERα, не только TAM и ICI являются первичными антагонистами ERα и ERβ, но они также действуют как агонисты GPR30 из-за высокого сродства к нему. ACSF1 Экспрессия мРНК была значительно увеличена в первичных гепатоцитах, обработанных эстрогеном, но значительно снизилась при применении комбинированного лечения эстрогеном и MPP, TAM или ICI.Таким образом, было показано, что экспрессия куриного ACSF1 регулируется эстрогеном, опосредованным через ERα. ACSF2 , с сайтом AP1 в его промоторе, было соответственно уменьшено после лечения одним эстрогеном, но, что интересно, снова значительно уменьшилось после лечения MPP, TAM и ICI. Было доказано, что существуют существенные транскрипционные различия в этих генах, содержащих сайт AP1 в своих промоторах, некоторые из которых негативно регулируются эстрогеном при связывании с ERα, а другие положительно регулируются им при связывании с ERβ 35 .В настоящее время, насколько нам известно, нет доказательств, подтверждающих динамическую регуляцию генов с сайтом AP1 при связывании с GPR30. Антагонисты эстрогенов, а именно тамоксифен и ICI 182,780, могут стимулировать транскрипцию через репортер AP1 в присутствии ERβ 13,36,37 . При заражении эстрогеном мРНК ACSF2 была заметно снижена, что позволяет предположить, что эстроген может регулировать ACSF2 посредством связывания с ERβ. Однако после лечения соответствующими MPP, TAM и ICI в сочетании с эстрогеном снова произошло заметное снижение ACSF2 , что противоречило вышеупомянутому представлению о том, что TAM и ICI могут стимулировать транскрипцию через репортер AP1 в присутствии ERβ. .Ограничение регуляции экспрессии генов за счет ряда факторов и диверсификация паттернов регуляции эстрогена на уровне транскрипции обеспечивают множество возможных объяснений специфического молекулярного механизма эстрогена на экспрессии ACSF2 , например индукция эстрогеном факторов транскрипции и опосредованное метилирование. пользователя GPR30. Это показывает, что молекулярный механизм, который позволяет эстрогену контролировать экспрессию ACSF2 , не полностью изучен и требует дальнейшего изучения.

ACS отвечают за синтез ацил-КоА из неполярных гидрофильных жирных кислот и играют важную роль во многих метаболических процессах, включая синтез холестерина и других липидных молекул, а также цикл трикарбоновых кислот. Активация FA включает двухстадийную и АТФ-зависимую реакцию, катализируемую ферментами ACS с образованием промежуточного ацил-AMP, который затем превращается в ацил-CoA 4 . Длина углеродной цепи жирных кислот определяет субстратную специфичность для различных ACS 4,38 .Было высказано предположение, что ACSF1 катализирует однократную конденсацию ацил-КоА и малонил-КоА до ацетоацетил-КоА 39 . Как сообщалось ранее, ACSF2 надежно активировал восьмиуглеродный октаноат жирных кислот со средней длиной цепи в ACSF2 -гиперэкспрессирующих клетках 5 . Кроме того, было доказано, что более низкая экспрессия ACSF2 снижает образование ацетил-КоА, который используется для участия в цикле трикарбоновых кислот, чтобы способствовать высвобождению АТФ; это, следовательно, способствовало ингибированию высвобождения АТФ, а затем уменьшению апоптоза гранулезных клеток, в конечном итоге увеличивая продуктивность кладки у гуся 6 .Интересно, что наши результаты определили, что не было изменений в экспрессии мРНК ACSF2 в яичниках, но были значительные изменения в печени цыплят с продолжающейся яйценоскостью, неактивной яйценоскостью и различными физиологическими состояниями цыплят. Поэтому мы предположили, что не яичники, а печень ACSF2 принимает активное участие в производстве куриных яиц. Разница в том, что ACSF2 показал более низкую экспрессию в яичниках гусей с высокой яйценоскостью, но не изменил яичников как у продолжающих, так и у неактивных кур, вместо этого более высокая экспрессия в печени бывших кур может означать различные роли ACSF2 в отношении производительности кладки цыплят и гусей, что требует дальнейшего изучения.Что касается ACSF3, он был предварительно идентифицирован как ацил-КоА-синтетаза, которая предпочитает субстрат для лигноцериновой кислоты, 24-углеродной жирной кислоты с очень длинной цепью. Была продемонстрирована новая функция ACSF3, заключающаяся в том, что он также служит митохондриальной малонил-КоА-синтетазой для генерации внутримитохондриального малонил-КоА из малоната у млекопитающих 25,40 , который затем может использоваться синтазой жирных кислот для генерации длительного жирные кислоты цепи, или использоваться для удлинения цепи жирных кислот 41 .Мы пришли к выводу, что эстроген, связываясь с ERα через ERE, положительно регулирует экспрессию ACSF1 , которая служит катализатором для ацетоацетил-КоА в результате однократной конденсации ацил-КоА и малонил-КоА, тем самым вызывая липогенез; эстроген через путь AP1 отрицательно регулирует экспрессию ACSF2 , которая имеет доступ к активации восьмиуглеродных жирных кислот со средней длиной цепи, влияя на метаболизм липидов и репродуктивную функцию.

Метформин предотвращает атрезию фолликулов у стареющих цыплят-несушек за счет активации PI3K / AKT и сигнальных путей кальция

Повышенная атрезия фолликулов возникает с возрастом и приводит к снижению плодовитости цыплят-несушек.Таким образом, уменьшение фолликулярной атрезии стареющей птицы является важнейшей мерой для поддержания стабильно высокой продуктивности яйцекладки. Сообщалось, что как средство против старения метформин играет важную роль в предотвращении старения у различных животных. В этом исследовании сравнивалось физиологическое состояние предиерархических фолликулов у кур-несушек (D280) и старых кур (D580) с последующим исследованием возможной способности метформина задерживать атрезию доиерархических фолликулов у кур возрастных D580. .Результаты показали, что способность отложения желтка в фолликулах снижается с возрастом, а точка контакта эндоплазматического ретикулума (ER-) митохондрий в ультраструктуре фолликулярных клеток уменьшается. Между тем, экспрессия сигнальных генов апоптоза увеличивалась в атретических небольших белых фолликулах. Впоследствии была создана модель индуцированной H 2 O 2 фолликулярной атрезии для оценки способности метформина усиливать отложение желтка и ингибировать апоптоз в атретичных небольших белых фолликулах.Метформин ингибировал апоптоз за счет регуляции взаимодействия ассоциированных с митохондриями мембран ER и сигнального пути инсулина (PI3K / AKT). Кроме того, метформин регулирует гомеостаз ионов кальция для снятия ER-стресса и ингибирует высвобождение факторов апоптоза митохондрий (BAD и каспазы). Кроме того, метформин активировал PI3K / AKT, который подавлял активацию BAD (ниже инсулинового сигнального пути) в атретических фолликулах. Кроме того, уровень эстрогена в сыворотке и экспрессия рецептора эстрогена- α в печени повышались после приема добавок метформина в рацион кур D580.Эти результаты показали, что введение диетического метформина активировало путь передачи сигналов PI3K / AKT и кальция и увеличивало отложение желтка для предотвращения атрезии куриных фолликулов.

1. Введение

Куры-несушки демонстрируют быстрое снижение яйценоскости по мере старения. В возрасте 80 недель у кур значительно снижается яйценоскость, а функции яичников заметно снижаются [1, 2]. Снижение яйценоскости у кур D580 в основном объясняется тремя причинами: (1) ускоренной потерей предиерархических фолликулов (PHF) в старых яичниках, (2) повышенной атрезией, испытываемой PHF; (3) снижение способности образования предшественников желтка в печени и уменьшение отложения желтка в PHFs [3, 4].Фолликул в основном состоит из трех типов клеток: одного ооцита и двух видов соматических клеток (GC для клеток гранулезы и TC для клеток теки). ГК играют фундаментальную роль в атрезии фолликулов. В атретических фолликулах (AFs) апоптоз происходит раньше в GC, чем в ооцитах и ​​TC [5, 6]. Основываясь на предыдущем исследовании, наблюдается более значительное снижение количества PHF у кур D580, чем у кур D280, и уменьшение количества фолликулов подвергается атрезии [7].Следовательно, важно предотвратить или отсрочить атрезию фолликулов, чтобы поддерживать конкурентоспособность при кладке.

Сообщается, что решение об апоптозе или выживании GC тесно связано с множественными сигнальными путями. Ингибирование PI3K / AKT в сигнальном пути инсулина ускоряет апоптоз GC и приводит к преждевременной недостаточности яичников [8, 9]. Напротив, активация PI3K стимулировала дифференцировку ГК в фолликулах [10]. Что касается повышения выживаемости GC, AKT, как полагали, помогает фолликулостимулирующему гормону (FSH) стимулировать секрецию стероидных гормонов и пролиферацию GC [11, 12].Однако мало что известно о функциях сигнального пути PI3K / AKT в развитии и росте фолликулов яичников цыплят, особенно о его функциях в предотвращении атрезии фолликулов, которая имеет решающее значение для улучшения воспроизводства яиц.

Активированный стресс эндоплазматического ретикулума (ER-стресс) и путь апоптоза митохондрий вредны для выживания GC [13]. Во-первых, чрезмерная активация ER-стресса и активация сигнального пути апоптоза митохондрий могут вызвать дисбаланс внутриклеточных ионов кальция [14].Хорошо известно, что трансдукция кальция играет ключевую роль в контроле судьбы стареющих клеток [15]. Связанные с митохондриями мембраны ER (MAMs) являются функциональными доменами в этих двух органеллах, которые участвуют в обмене Ca 2+ [16]. МАМ состоит из регуляторного белка 75 глюкозы (GRP75) и канала рецептора инозитол-1,4,5-трифосфата (IP 3 ) (IP 3 R, канал высвобождения Ca 2+ из ER), который является ассоциирован с митохондриальным унипортером кальция (MCU, кальциевый сигнальный канал IP3R-GRP75-MCU) [17].Транспорт кальция из МАМ имеет решающее значение для регуляции функции митохондрий и энергетического метаболизма [18]. Нокдаун GRP75 снижает способность ER переносить Ca 2+ в митохондрии [19]. Во-вторых, нефосфорилированный BAD (нижестоящий транскрипционный фактор ATK) индуцировал высвобождение цитохрома C (Cyt c ) и, в конечном итоге, активировал каспазу, что приводило к апоптозу митохондрии. Эта функция достигается за счет повышения уровня кальция в митохондриях (перегрузки кальцием) [20, 21].Однако до сих пор неясно, какое участие принимает путь транспорта кальция и МАМ в апоптозе вызванной старением фолликулярной атрезии.

Образование и отложение желтка зависят в основном от оси печень-кровь-яичники при регуляции нескольких гормонов, но преимущественно от эстрогена (E 2 ), который стимулирует синтез аполипопротеина B (ApoB) и вителлогенина II (VTGII) в печень за счет связывания с рецептором эстрогена α (ER- α ) [22, 23].Недавние исследования показывают, что снижение уровня E 2 в сыворотке крови в процессе старения цыплят в конечном итоге снижает способность образования желтка [24]. При отложении желтка основными компонентами предшественников желтка являются липопротеины очень низкой плотности (ЛПОНП) и вителлогенин (VTG). VLDL синтезируется в печени и впоследствии транспортируется в ооциты посредством VLDLR-опосредованного эндоцитоза [25]. Сообщалось, что VLDLR, существующие на поверхности мигрирующих нейробластов, могут активировать PI3K / AKT через p-Dab1 [26].Кроме того, рецептор, активируемый пролифератором пероксисом (PPAR), является важным фактором для регулирования дифференцировки и функции адипоцитов, и он играет решающую роль в производстве глицерина, а также в поглощении, синтезе, хранении и гидролизе липидов [27]. Повышенная экспрессия PPAR-γ увеличивала способность транспорта и поглощения липидов в соответствующих клетках кур-несушек [25]. Кроме того, белок окклюдин, который расположен на периферии GCs, д. Ингибировать транспорт предшественников желтка, закрывая щелевые соединения между GC [28, 29].Хотя было показано, что старение у кур-несушек сопровождается снижением синтеза желтка [24], снижение способности отложения фолликулярного желтка у стареющих кур требует дальнейшей оценки, особенно в фолликулах, которые вызывают атрезию.

Метформин (Met), производное от лекарственного средства на травах под названием Golega officinalis , используется для лечения лактона домашнего скота в животноводстве [30]. Недавно было продемонстрировано, что Met играет важную роль в замедлении старения [31].С одной стороны, сообщалось, что Met задерживает процесс старения яичников у мышей, подавляя потерю фолликулов и поддерживая фолликулярный резерв. Кроме того, он может снимать окислительный стресс яичников, а также производство митохондриальных АФК [32, 33]. С другой стороны, Met был способен снижать экспрессию GRP78 (разновидность маркера ER-стресса), которая была индуцирована вызывающим старение лекарством D-галактозой [33]; следовательно, Met может предотвращать апоптоз, вызванный ER-стрессом. Однако неизвестно, может ли Met вызывать снижение апоптоза за счет поддержания баланса концентрации Ca 2+ / участия в MAM, хотя сообщалось, что он снижает стресс ER / стресс митохондрий [34].Кроме того, Met уменьшал синдром поликистозных яичников, стимулируя путь PI3K / AKT [35]. Между тем, Met уменьшал воспаление гладких мышц сосудов, которое спровоцировано липополисахаридом, способствуя экспрессии PPAR-γ [36]. Однако функция Met в регулировании отложения AF в желтке неизвестна. Более того, неясно, может ли Met уменьшать атрезию фолликулов посредством пути PI3K / AKT.

В этом исследовании изменения отложения в желтке и экспрессии генов или белков, связанных с апоптозом, сравниваются среди D280-SWF (маленькие белые фолликулы, 2-4 мм, разновидность PHF), D580-SWF и атретичных малых белых фолликулов. фолликулы (ASWF) от кур D580.Чтобы раскрыть механизм атрезии фолликулов и роль Met в замедлении атрезии фолликулов (включая отложение желтка и апоптоз клеток), была создана модель ASWF путем индукции с помощью H 2 O 2 . Ингибитор PI3K (тазелисиб) используется для ингибирования PI3K в ASWF с целью изучения роли Met в пути PI3K / AKT. Результаты могут стать основой для предотвращения старения яичников и продления периода яйцекладки у несушек.

2. Материалы и методы
2.1. Животные

Белые куры Hyline (D280 и D580) были получены с местной птицефермы и содержались в клетках со свободным доступом к корму и воде при контролируемом световом периоде 14 часов свет: 10 часов темноты. Все экспериментальные процедуры проводились в соответствии с Руководящими принципами по уходу и использованию лабораторных животных Чжэцзянского университета (ZJU20170660).

2.2. Сбор и культивирование PHF

Яичники были выделены у кур D280 и D580 для сбора PHF.Фолликулы трижды промывали ледяным фосфатно-солевым буфером (PBS) для следующих экспериментов. Отдельные PHF культивировали в 24-луночных культуральных планшетах, содержащих 500 мкл л полной среды Игла, модифицированной Дульбекко (DMEM с высоким содержанием глюкозы, Sh40243.01) с 5% фетальной сывороткой теленка (FCS; HyClone, Тауранга, Новая Зеландия), 10 мк мкг / мл инсулина, 5 мкг мкг / мл трансферрина, 30 нМ селенита (ITS, Sigma-Aldrich, Миссури, США), 100 МЕ / мл пенициллина и 100 мкг г / мл стрептомицина при 38.5 ° C и 5% CO 2 в течение 72 часов. Медиа обновлялись каждые 24 часа.

2.3. Обработка химическими веществами

Для эксперимента in vitro было три обработки PHF: (a) Для создания модели ASWF в среду добавляли H 2 O 2 в различных концентрациях (0, 0,1, 1 и 10 мМ; Sinopharm Chemical Reagent Co. Ltd., 10011218, Шанхай, Китай). (b) Для скрининга оптимальной концентрации Met (в форме гидрохлорида метформина, M107827, Aladdin) индуцированные H 2 O 2 ASWF обрабатывали различными концентрациями Met (0,0.2, 2 и 20 мМ). (c) Для определения функции Met в сигнальном пути инсулина (PI3K / AKT) атретические фолликулы обрабатывали 2 мМ Met и 0,3 мМ тазелисибом (ингибитор PI3K; синонимы: GDC-0032, RG-7604 и MCE) отдельно или в комбинации. Для включения бромдезоксиуридина (BrdU, 19-160, Sigma-Aldrich, WI, USA) PHF инкубировали в течение 24 часов с BrdU в течение 72 часов, затем PHF собирали для последующих определений. Для эксперимента in vivo тридцать кур D580 (вес ~ 2 кг) были выбраны случайным образом и разделены поровну на две группы (экспериментальная / контрольная).Каждой курице из экспериментальной группы давали таблетку Met с замедленным высвобождением (h41021359, Shanghai Hengshan Pharmaceutical Co. Ltd.) в концентрации 62,5 мг / кг (BW) с 3 мл чистой воды каждый день в течение семи дней подряд (в соответствии с дневной скоростью яйцекладки , Дополнительный рисунок 1B). Контрольной группе давали равный объем чистой воды. Образцы крови были взяты из вен крыла для приготовления плазмы и сыворотки на 8-й день. Затем кур умерщвляли путем цервикального кровотечения после анестезии пентобарбиталом натрия и отбирали образцы тканей (печени и PHF) для последующих экспериментов.

2.4. Морфологическое наблюдение

Фолликулы фиксировали в 4% параформальдегиде в течение 24 часов при 4 ° C и обезвоживали градуированным этанолом, затем заливали парафином при 60 ° C и делали срезы толщиной 4 мкм мкм. Окрашивание H&E проводили по стандартной гистологической методике [13]. Иммунофлуоресценция или иммуногистохимическое окрашивание (IF / IHC) выполняли, как сообщалось ранее [37]. Первичные антитела в IF / IHC следующие: кроличьи анти-каспаза 3 (1: 100, ET1602-39), антицитохром C (1: 100, ET1610-60), антимитохондриальный фузин 2 (1: 100, ER 1802-23), анти-PI3K (1: 100, Et1608-70), мышиный анти-BAD (1: 50, RT1067), анти-GRP75 (1: 50, M1603-1, HuaBio, Ханчжоу, Китай), кролик анти-VLDLR (1: 100, MAB2258), мышиный анти-ER- α (1: 200, NB300-560, Novus Biologicals, США), антиокклюдин (1:50, sc-133256, Santa Cruz Biotechnology Inc. ., Санта-Крус, США) и антитела против BrdU (1: 200, AB_2314035, G3G4; DSHB, Айова (IA), США). Флуоресцентные изображения слайдов визуализировали с помощью флуоресцентного микроскопа (Olympus IX70, Токио, Япония). Результаты IHC и окрашивания H&E наблюдали под микроскопом (Eclipse 80i, Nikon, Япония), а изображения фотографировали с помощью цифровой камеры (DS-Fi1, Nikon, Япония).

2,5. Анализ TUNEL

Анализ TUNEL проводили с использованием набора для анализа TUNEL (Vazyme Biotech Co.Ltd., Нанкин, Китай) в соответствии с протоколом производителя. TUNEL-положительные клетки были отмечены зеленым.

2.6. Измерение биохимических параметров крови

Сыворотка E 2 определяли с использованием набора для тестирования ELISA E 2 (ERK R7005, Endocrine Technologies, Inc., Сан-Франциско, Калифорния, США) в соответствии с инструкциями производителя. Уровни триацилглицерина в плазме (TG, A111-1-1, в диапазоне 0-10,34 мМ,), липопротеинов высокой плотности (HDL, A112-1-1, в диапазоне 0.065-3,8 мМ,), свободные жирные кислоты (FFA, A042-2-1, в диапазоне 9,1-2000 мк M,) и липопротеины низкой плотности (ЛПНП, A113-1-1, в диапазоне 0,2-12 мМ) определяли с использованием коммерческих наборов (Nanjing Jiancheng Bioengineering Institute, Нанкин, Китай).

2.7. Вестерн-блот

PHF гомогенизировали в ледяном буфере для анализа RIPA (радиоиммунопреципитации) (P0013B) с ингибитором протеиназы (ST506, Beyotime Biotechnology, Нанкин, Китай). Общий белок определяли с использованием набора для анализа белков Enhanced BCA (бицинхониновая кислота) (P0010, Nanjing Jiancheng Bioengineering Institute, Нанкин, Китай).Равное количество белка (24 мкл г) загружали и разделяли с помощью 10% геля SDS-PAGE и переносили на PVDF-мембрану (Merck Millipore, Billerica, USA). Мембрану блокировали 5% обезжиренным молоком в течение 2 ч, а затем инкубировали в течение ночи при 4 ° C с соответствующими первичными антителами, включая мышиные анти-GRP78 (1: 1000, sc-376768), анти-CHOP (1: 1000, sc- 3), анти-CAMK II (1: 500, sc-376828), анти-окклюдин (1: 200, sc-133256, Santa Cruz Biotechnology Inc., Санта-Круз, США), анти-ER- α (1 : 1000, NB300-560, Novus Biologicals, США), анти-BAX (1: 200, EM1203) или GRP75 (1: 1000, M1603-1), кроличий анти-PPAR гамма (1: 1000, ET170257), анти- caspase3 (1: 1000, ET1602-39), анти-Akt1 / 2/3 (1: 1000, ET1609-51), анти-фосфо-Akt (1: 1000, ET1607-03), анти-GSK3 beta (1: 1000, ET1607-71), антифосфо-GSK3 beta (1: 1000, ET 1607-60, HuaBio, Ханчжоу, Китай) и мышиные анти-VLDLR (1: 1000, MAB2258, Novus Biologicals, США), за которыми следует инкубация с конъюгированными с пероксидазой хрена козьими антителами против кролика или против мышиных вторичных антител (sc-2004 или sc-2005, Santa Cruz Biotechnology Inc., Санта-Крус, США) в течение 1 ч при комнатной температуре. β -актин (распознаваемый мышиным анти- β -актином, 1: 1000, R1207-1, HuaBio, Ханчжоу, Китай) использовали в качестве внутреннего контроля. Для количественной оценки белка изображения были количественно определены и проанализированы с использованием программного обеспечения ImageJ; для серого анализа белков использовался метод нормализации, и контрольная группа обозначена как «1».

2,8. Просвечивающая электронная микроскопия (ПЭМ)

С помощью ПЭМ наблюдали три типа PHF (D280-SWF, D580-SWF и ASWF).Фолликулы фиксировали в 2,5% глутаровом альдегиде при 4 ° C в течение 24 часов. ПГФ были постфиксированы 1% тетроксидом осмия (OsO 4 ) в течение 1,5 ч при комнатной температуре; затем их промывали PBS, затем дегидратировали этанолом в возрастающей концентрации и заливали эпоксидной смолой LX 112. Кроме того, PHF были разделены с помощью ультрамикротома Leica EM UC7 (Leica Microsystems GmbH Wetzlar, Германия) и установлены на медных решетках, покрытых формваром. Ультратонкие срезы окрашивали 8% водным раствором уранилацетата и щелочным цитратом свинца в течение 5-10 мин, затем наблюдали и фотографировали с помощью Tecnai G2 Spirit (компания FEI, Хиллсборо, США) с ускоряющим напряжением 120 кВ при различном увеличении.Длину органелл определяли количественно с помощью программы ImageJ.

2.9. Экстракция РНК, qRT-PCR и анализ РНК-Seq

TRIzol Reagent (Invitrogen, Carlsbad, CA) использовали для экстракции общей РНК из фолликулов. КДНК получали из 2 мкг г тотальной РНК с использованием набора HiScript II 1st Strand cDNA Synthesis Kit (Vazyme Biotech Co. Ltd., Nanjing, China) в соответствии с протоколом производителя. QRT-PCR выполняли с использованием набора SYBR® Premix Ex Taq ™ (Takara, DRR420A, Kyoto, Japan) на системе обнаружения ПЦР в реальном времени ABI 7500HT (Applied Biosystems, Foster City, США) при следующих условиях: 95 ° C в течение 10 минут, а затем 40 циклов при 95 ° C в течение 30 секунд, 64 ° C в течение 34 секунд и 72 ° C в течение 30 секунд.Сравнения уровней экспрессии определяли по формуле, нормированной на β -актин. Последовательности праймеров перечислены в таблице 1. RNA-seq проводился в соответствии с предыдущим исследованием [38].

90_590
90_590
2 CCND1 CDK2 NM_001199857.1 МТР АроВ VLDLR BCL2 Р53 CYP17A1 CYP19A1 MCU CaMKII XM_015288323.2 MFN1 MFN2 PI3K GLUT4 XM_025145523.1 IRS AKT1 VTGII NM_001031276 ОВР GRP78 GRP75 FSHR NM_205079.1 CALR

Имя гена Регистрационный номер Последовательность праймера (5-3) Длина продукта (п.о.)
F: GGGCGTCAACCTAAACAGCA
Р: AGCCAACGTATCCGCATTGT
97
NM_205381.1 F: CCTCAAGAAAAGCCGGTTGC
Р: CTGCGGTCAGAGGAATCGTT
86
F: TCCGTATCTTCCGCACGTTG
Р: GCTTGTTGGGATCGTAGTGC
183
NM_001109784.2 F: GCAGATGGACAGAGTTGGCT
Р: TTCCCTCTCCTCGCAGTGTA
93
NM_001044633.1 F: AGGTAGAGGCAGGACGCATA
Р: AGAATGCTACGTCCCACACG
268
NM_205229.1 F: ATGGCCAGGATCGTAGACTT
Р: TCATTTATCTGAGGAGCAGG
292
PPAR-γ NM_001001460. 1 F: CAAGGCAGCGGCAAAATAAC
Р: GTGCCCATAAATGATGGCCTAA
187
Occludin NM_205128.1 F: CTCTGGGAAGGGCTGAGGT
Р: GCCTTCCCAAAAAGCCCTGA
170
NM_205339.2 F: ATCGTCGCCTTCTTCGAGTT
Р: ATCCCATCCTCCGTTGTCCT
150
NM_205264.1 F: AACCATTGCTGGAACCCACT
Р: GCCAGTTGCTGTGATCCTCA
99
ER-α NM_205183. 2 F: TAGTTCCGCTCTACGACCTCTT
Р: AGTTGGTTTCGGTTCTCCTCTT
106
NM_001001901.2 F: GGAGCTGACAGATGACCACC
Р: TCTTCTGGACCTCGGGGRAG
125
NM_001001761 Р : CCTCTGCTGGAGATGGTTTT
R: GCTGATCCACTTTAGTCACTCTGA
68
IP3R KY2.1 F: CTACTTGAAGGCGGAAACCCT
Р: GCCCGCCATGTCTGAAGTAT
162
XM_025151715.1 F: CTGAAATGCATGGCTGCACG
Р: GTTTGAGGGTGAACTGGCAAC
164
F: AGATGAGGATCTGAAAGTGCGT
Р: TTCCCCAGTGCTTCAGGTTC
144
NM_024200.4 F: CGGAGTGAGTGTCCGCTG
Р: GTGCTTCAGTGGAGATACCGT
180
XM_015297206.2 F: GTGGTTGTGTTTTGTTACTTCCG
Р: AGGGACATTGCGTTTTCAGG
275
NM_001004410.1 F: ACACGTTCTTGTGCTGGCTA
Р: TAAGACAAAGGGCACACGCT
177
F: CGTGGGTGAGCTTTCCAGAT
Р: CATGTAGCGCCCAAAGAACG
86
XM_003641084.4 F: GTCATCCCGCTCTACCAGTG
Р: TTCTCCGCCAGCATAGCAAA
110
NM_205055.1 F: GCGAGAAGGGGAGGAGGA
Р: CCTGAACTCCAGCAGAAGGG
272
GSK-3β XM_004938179.3 F: ATGGACTAAGGTCTTCCGGC
Р: CTCTCGCCCGTTTGGTAACT
166
F: TTGCAAGCTGATGAACACACAC
Р: GATTGCTTCATCTGCCAGGTC
192
X95100.1 F: TGAAGCCTGCTGTGACTGTG
R: AAGTGACTGACAGGAGTGAGC
249
NM_205491.1 F: GAATCGGCTAACACCAGAGGA
Р: CGCATAGCTCTCCAGCTCATT
118
NM_001006147.1 F: GCAGCAGGCTTCCTTGAAAC
Р: ATTCCGCCCATTTCTGCTCA
198
F: ACCTGCCTGGATGAGCTAAA
Р: ATCCATGACTTGGCAGGAAG
136
XM_025145796.1 F: GTGGAGACCCCGACAGATTG
Р: GTGGAGACCCCGACAGATTG
99
Каспаза 9 XM_424580.6 F: GCTTGTCCATCCCAGTCCAA
Р: TGCTGCTGACACCTTCACCATTC
95
β-актина NM_205518 F: ACACCCACACCCCTGTGATGAA
Р: TGCTGCTGACACCTTCACCATTC 136

2.10 . Статистический анализ

Все данные были представлены в виде (SEM) и проанализированы односторонним дисперсионным анализом (ANOVA) с LSD и множественными диапазонными тестами Дункана с использованием SPSS 20.0 программное обеспечение. считалась статистически значимой разницей.

3. Результаты
3.1. Апоптоз у ASWF

По сравнению со здоровыми SWF того же размера (2-4 мм), ASWF у кур D580 потеряли свою эластичность и стали тусклыми и темными с несколькими точками кровотечения (дополнительный рисунок 1A). Более того, в анафазе атрезии фолликулы уменьшились, и их форма стала более заметной. С этого момента ASWF того же размера, что и здоровые фолликулы, больше не обязательно находились в той же иерархии.Поэтому для эксперимента были выбраны SWF в начале атрезии. Окрашивание H&E использовали для наблюдения за морфологией PHF и ASWF. Результаты показали, что слой гранулезы (GL) ASWF был рыхлым, а слой тека (TL) утолщался по сравнению с SWF (D280 и D580). Однако не было значительных различий в морфологии SWF у кур D580 и D280, поскольку все их GL были близко расположены, а GC имели регулярную морфологию. Кроме того, толщина TL была умеренной (Рисунок 1 (а) A – C).Более того, изображения IF показали, что белок caspase3 в основном экспрессируется в GL PHF у кур D580 и TL у ASWF (Рисунок 1 (a) D – F). Вестерн-блоттинг был использован для изучения экспрессии белков, связанных со стрессом ER (каспаза9, GRP78 и CHOP). Результаты показали, что эти белки проявляли более высокую экспрессию в ASWF и SWF кур D580, чем у кур D280 (Рисунок 1 (b) A). Между тем, результат qRT-PCR показал, что экспрессия BAX в ASWF и SWF кур D580 была значительно увеличена, в то время как экспрессия связанных с пролиферацией генов ( PCNA , CDK2 и CCND1 ) снизилась. значительно по сравнению с SWF у кур D280 (Рисунок 1 (b) B).

3.2. Сравнение способности депонирования желтка в ASWF и SWF

Для определения изменений способности депонирования желтка трех типов фолликулов IF был использован для сравнения распределения VLDLR в этих фолликулах. Результат показал, что белок VLDLR в основном экспрессировался в GL SWF кур D280, тогда как он редко экспрессировался в SWFs кур D580 и ASWF (Рисунок 2 (a) A – C). Кроме того, результаты анализа ELISA показали, что уровни сывороточного E 2 и плазменных HDL, LDL, FFA и Tchol значительно снизились у кур D580 (фиг. 2 (b) A и B).Между тем, уровень экспрессии генов MTP и ApoB значительно снизился в SWF кур D580 (рис. 2 (b) C). Кроме того, вестерн-блот-анализ показал, что белки PPAR- γ , VLDLR, FSH Receptor (FSHR) и ER- α проявляли самую низкую экспрессию в ASWF, тогда как они отображали самую высокую экспрессию в SWF кур D280 (Рисунок 2 (c ) А). Кроме того, результат qRT-PCR показал, что экспрессия генов PPAR-γ и VLDLR значительно снизилась как в ASWF, так и в SWF (куры D580), в то время как экспрессия мРНК окклюдина была наиболее высокой в ​​ASWF (Рисунок 2 ( в) Б).

3.3. Сравнение морфологии органелл в GC

Морфологию органелл в GC в трех типах фолликулов наблюдали с помощью ТЕМ. Изображения показали, что морфология ER в D280-SWFs-GC имеет одинаковый размер и регулярную плотность рибосомы на его поверхности. Что касается митохондрии в D280-SWFs-GC, она имела гладкую и плоскую внешнюю мембрану, и был виден ее внутренний гребень, образованный внутренним выступом. Однако ER и митохондрии в D580-SWF и ASWF проявляют признаки дегенерации.В ER обнаружена отшелушивающаяся и набухшая рибосома, а митохондрия потеряла свою правильную форму, набухла и потеряла внутренний гребень. Более того, было больше точек контакта ER-митохондрий в D280-SWFs, чем в D580-SWFs и ASWFs (Figure 3 (a) A – C). Впоследствии длина контакта ER-митохондрии (все точки соприкосновения на рисунке 3) была измерена с помощью программного обеспечения ImageJ, и результаты показали, что точка контакта ER-митохондрии и длина контакта в группах D580-SWF и ASWF были значительно уменьшены, поскольку по сравнению с таковыми из D280-SWF (рис. 3 (б)).

3.4. Создание модели фолликулярной атрезии

Ранее сообщалось, что H 2 O 2 способен вызывать апоптоз в яичнике цыпленка [39]. Для изучения воздействия H 2 O 2 на атрезию фолликулов в качестве моделей были выбраны SWF и ASWF (in vivo). Атрезию фолликулов, вызванную H 2 O 2 , определяли по следующим трем аспектам: (a) Апоптоз клеток: результаты окрашивания H&E показали, что GL начала терять свою полную структуру и расположение GC перестало быть плотным, когда концентрация H 2 O 2 была выше 1 мМ.Кроме того, анализ TUNEL показал, что TUNEL-положительные клетки (зеленые) значительно увеличились как в TL, так и в GL после обработки H 2 O 2 (Рисунок 4 (a) A, I – V). Между тем, анализ вестерн-блоттинга показал, что экспрессия белков BAX и окклюдина постепенно увеличивалась по мере увеличения концентрации H 2 O 2 , тогда как тенденция экспрессии белка PCNA показывала противоположные изменения (Рисунок 4 (a) B, Я). Более того, результат qRT-PCR согласовывался с анализом вестерн-блоттинга (Рисунок 4 (a) B, II) (b) Способность к отложению желтка: IF показал, что белки окклюдина и VLDLR в основном экспрессируются в GL, а экспрессия окклюдина была повышена с повышением ступенчатой ​​концентрации H 2 O 2 , в то время как экспрессия VLDLR показывала противоположную тенденцию (Рисунок 4 (b) A, I – V).Результат qRT-PCR показал, что экспрессия генов в SWF была сопоставима с ASWF после обработки 10 мМ H 2 O 2 (Рисунок 4 (b) B, I). Однако экспрессия мРНК PPAR-γ , VLDLR и окклюдина в SWF была аналогична ASWF, когда концентрация H 2 O 2 была выше 1 мМ (Рисунок 4 (b) B, II (c) Синтез гормона: экспрессию белков рецепторов гормонов (ER-, и FSHR) определяли с помощью Вестерн-блоттинга.Результаты показали, что экспрессия ER- α и FSHR в SWF была сопоставима с ASWF, когда концентрация H 2 O 2 была выше 1 мМ (Фиг.4 (b) C). На основании этих результатов для создания модели ASWF был выбран 1 мМ H 2 O 2 .

3.5. Влияние Met на ингибирование апоптоза при атрезии фолликулов

Для исследования ослабляющего действия Met на индуцированную H 2 O 2 атрезию фолликулов, доза Met была проверена на основе четырех концентраций (0,0.2, 2 и 20 мМ). Результат анализа TUNEL показал, что обработка 0,2 и 2 мМ Met ингибировала апоптоз GC в ASWF (индуцированный H 2 O 2 ) по сравнению с контрольной группой (Рисунок 5 (a) A – D ). Что касается белковых аспектов, 2 мМ Met значительно увеличивали экспрессию PCNA, в то время как 2 мМ Met представляли лучший эффект по ингибированию каспазы 3 (фиг. 5 (b) A). Кроме того, обработка 2 и 20 мМ Met усиливала экспрессию PCNA и CCND1 и подавляла экспрессию BAX на уровне мРНК (фигура 5 (b) B).В заключение, концентрация 2 мМ Met была выбрана в качестве оптимальной дозы.

3.6. Профили дифференциально экспрессируемых генов (DEG) между D280 и D580 SWF

Кластерный анализ DEG в путях кальция, PPAR и PI3K / AKT показал, что паттерны экспрессии генов D280 SWF отличаются от D580 (фиг. 6). Многие гены в этих трех путях демонстрируют значительно различающуюся экспрессию между D280 и D580 SWF. Например, экспрессия мРНК PIK3CD , AKT3 , NCX1 , EGFR , SCP2 , CPT1A и FABP3 мРНК в SWF D580 значительно снизилась по сравнению с SWF D580.Однако мРНК ATP2B2 , PTK2B , ITPR3 и NCX1 в SWF D580 значительно увеличились по сравнению с SWF D280 (Таблица 2).


(a) Сигнальный путь инсулина

adj 2 905 905 905 905 905 905 905 905 905 GTPase, тип Rab3 905G86 905G86 -0,28405 Сигнальный путь кальция


Идентификатор гена Символ гена

Гены с повышенной регуляцией
ENSGALG00000007919 EIF4E2 0.20281 +0,005635 Перевод фактор инициации EIF-4e
ENSGALG00000006418 PDPK1 0,21168 0,00028551 тирозин-протеинкиназы, каталитический домен
ENSGALG00000001267 MAP2K2 0,18059 0,020795 Каталитический домен серин-треонин / тирозин-протеинкиназы
ENSGALG00000002485 PHKG1 0.21809 +0,0065997 киназы фосфорилазы, гамма каталитической субъединицей
ENSGALG00000007373 PRKAB1 0,20238 0,0012886 Иммуноглобулин Е-набор
ENSGALG00000026692 Н-РАН 0,1801 0,0062565 Малый домен GTP-связывающего белка
ENSGALG00000010440 MKNK1 0,3733 0,002099 Тирозин-протеинкиназа, каталитический домен
ENSGAL5870 626435 0,01324 Ассоциация с доменом комплекса SNF1 (ASC)
ENSGALG00000006885 H-RAS 0,32313 Малое суперсемейство GTPase Предполагаемая регуляторная субъединица фосфатазы
Гены с пониженной регуляцией
ENSGALG00000002583 PIK3CD -0.41721 0,0039568 Фосфоинозитид-3-киназа, вспомогательный (PIK) домен
ENSGALG00000007023 PRKAR2A -0.3031 0,0003467S865

0

0

0

0,0003467 905 G8905

0

0 908 GAMP

0,0003467 905 G-регулятивный субъект
0,049919 Домен гомологии плекстрина
ENSGALG00000027188 SREBP-1 -0,32066 0.026855 Домен, подобный фактору некроза опухоли
ENSGALG00000005198 RPS6KB1 -0,31356 0,0034049 Тирозин-протеинкиназа, каталитический домен
98692 905 PLCB2 G-86G-киназа ENSG- 0,000064666

Идентификатор гена Символ гена Log 2 FC adj
ENSGALG00000003901 P2RX4 0.42582 p2x2 пуриноцептора
ENSGALG00000004096 CHRNA7 0,80665 0,000017539 никотиновых ацетилхолиновых рецепторов
ENSGALG00000009808 VT4 1,1702 0,015681 Вазопрессин рецептора
ENSGALG00000002485 PHKG1 0,21809 0,0065997 Киназа фосфорилазы, гамма-каталитическая субъединица
ENSGALG00000007779 ADCY9 0.14706 0,024756 Нуклеотидциклаза
Гены с пониженной регуляцией
ENSGALG00000004829 ATP2B2 -0,32692

0

0 CTP2B2

-0,32692 2
-0,55479 0,0041353 Фосфолипаза C, фосфатидилинозитол-специфическая, EF-ручная
ENSGALG00000016564 PTK2B -1 .+2119 0,043151 FERM центральный домен
ENSGALG00000003750 PLCG1 -0,35419 0,0010363 фосфолипазы С, фосфатидилинозитол-специфический, Y домен
ENSGALG00000003149 ITPR3 -0,93013 0,00049355 Рецептор инозитол-1,4,5-трифосфат-связывающего белка
ENSGALG00000010013 EDNRA -0.71035 эндотелина рецептор
ENSGALG00000001564 ATP2A3 -0,73625 0,0012319 Р-типа АТФазу
ENSGALG00000008544 NCX1 -1,0991 0,000055847 натрия / теплообменник кальция , изоформа 1
ENSGALG00000012363 EGFR -0,18932 0,012951 Белок, связывающий инсулиноподобный фактор роста, N-концевой51033 Армадилло типа раза
ENSGALG00000013929 PDGFRA -0,52088 0,0036094 Тирозинпротеинкиназный, каталитический домен
ENSGALG00000016691 SLC25A6 -0,14184 0,016577 Транслокатор адениновых нуклеотидов 1
ENSGALG00000005805 PLCD1 -0,49646 0,005357 Домен гомологии плэкстрина
ENS95790 LG0000 4467 G-белок-связанный рецептор, родопсин-подобный
ENSGALG00000021313 PDGFRB -0,43421 0,0035472 Протеинкиназа, C-концевой
ENSGALG00000008875 PLCB1 -0,44568 0,0055755 Фосфолипаза C, фосфатид1092902 905 9139

905 9139 c) Сигнальный путь отложения желтка

9 0587 ENSGALG00000007077 подавляются

Идентификатор гена Символ гена Log 2 FC с поправкой
CPT1A 0.28028 ацилтрансфераза ChoActase
ENSGALG00000010652 SCP2 0,12657 0,030231 тиолаза типа
ENSGALG00000003286 ACSBG1 0,87572 0,030231 АМФ-зависимой синтетазы
ENSGALG00000000620 FABP3 0,52972 Связывание цитозольных жирных кислот
ENSGALG00000015591 ACOX3 0.33528 0,0039558 ацил-КоА-дегидрогеназа
ENSGALG00000015425 CPT1A -0,25383 0,00071396 триацилглицерол липазы семейства
ENSGALG00000007178 SCP2 -0,47547 Жирная кислота
ENSGALG00000008088 ACSBG1 -0,21285 0,0004066 AMP-зависимая синтетаза
ENSGALG0000580005739
ENSGALG0000580005739
ENSGALG0000580005739 134 +0,0028215 Жирная кислота десатуразы, тип 1, ядро ​​
ENSGALG00000002626 ACOX3 -0,31722 0,0075549 Ядерный гормон-рецептор
ENSGALG00000008202 CPT1A -0,15085 0,0034285 Связывание лиганда

3.7. Механизмы Met в борьбе со старением / атрезии

При окрашивании IF белки GRP75 и Cyt c в основном локализовались в GL, а небольшое количество распределялось в TL фолликулов.Экспрессия GRP75 снижалась, тогда как экспрессия Cyt c увеличивалась после обработки H 2 O 2 . Однако экспрессия GRP75 и Cyt c была аналогична контрольной группе после обработки Met (Рисунок 7 (a) A, I – IV). Результат ИГХ митохондриального слитого белка 2 (MFN2) показал аналогичные результаты с GRP75 в IF (Рисунок 7 (a) A, V – VIII). Вестерн-блоттинг и qRT-PCR были использованы для определения функции сигнального пути транспорта ионов кальция в этом исследовании.После обработки Met экспрессия этих белков (IP 3 R, caspase3, CAMKII и Cyt c ) значительно снизилась, в то время как экспрессия MFN2 и GRP75 показала противоположную тенденцию (фигура 7 (a) B). Результаты qRT-PCR показали, что тенденция экспрессии мРНК caspase9, GRP75 , CAMKII и MFN2 была аналогичной с обнаружением вестерн-блоттинга (фигура 7 (a) C). Между тем, путь передачи сигналов инсулина (PI3K / AKT) подавлялся после обработки H 2 O 2 .Кроме того, экспрессия белка BAD в TL и GL снизилась после обработки Met, в то время как экспрессия PI3K значительно увеличилась (фигура 7 (b) A). Результаты вестерн-блоттинга показали, что Met уменьшал соотношение p-GSK-3 β / GSK-3 β и улучшал соотношение p-AKT / AKT (фигура 7 (b) B). Более того, qRT-PCR выявила, что паттерны экспрессии мРНК PI3K , BCL2 и GLUT4 были аналогичны PI3K в IF (фигура 7 (b) C).Аналогичным образом, результаты вестерн-блоттинга и qRT-PCR показали, что Met восстанавливает снижение VLDLR и PPAR-γ , которое было вызвано H 2 O 2 , в то время как окклюдин демонстрировал противоположную тенденцию экспрессии (фигура 7 (c ) А и Б).

3.8. Стимулирующий эффект Met на пролиферацию клеток, участвующих в активации PI3K в GC ASWF

Для исследования функции Met в сигнальном пути PI3K / AKT в культуре ASWF использовали тазелисиб (разновидность ингибитора PI3K) [40].Результаты BrdU показали, что BrdU-положительные клетки (красные) в GL значительно уменьшились после обработки 0,3 мМ тазелисибом (фиг. 8 (a) A). Между тем, результаты IF показали, что тазелисиб подавляет экспрессию PI3K и увеличивает количество BAD-положительных клеток как в TL, так и в GL. Тем не менее, Met был способен облегчить эти явления (рис. 8 (b) A, I – IV). Более того, анализ вестерн-блоттинга показал, что тазелисиб увеличивал экспрессию Cyt c и соотношение p-GSK-3 β / GSK-3 β , а также подавлял экспрессию BCL2, PCNA и PI3K. как отношение п-АКТ / АКТ.Однако лечение Met значительно изменило эти изменения (рис. 8 (b) B, I). Кроме того, результат qRT-PCR дополнительно подтвердил вышеуказанные результаты (Рисунок 8 (b) B, II).

3.9. Стимулирующее действие Met на секрецию E
2 у кур D580

Для изучения эффекта Met in vivo таблетки с замедленным высвобождением Met вводили перорально в течение 7 дней (исходя из скорости воспроизводства яиц, дополнительный рисунок 1B). Результат IHC показал, что Met увеличивал ER- α -положительные клетки (коричневые) в печени кур D580 (рис. 9 (a) A и B).Однако не наблюдалось никаких значительных изменений уровней ЛПВП, СЖК и ТГ в плазме, а ЛПНП и Tchol значительно снизились после лечения Met (Рисунок 9 (b) A), тогда как уровни E 2 в сыворотке были значительно выше в Группа Met по сравнению с контрольной группой (Рисунок 9 (b) B). Между тем, экспрессия генов, связанных с отложением желтка ( VTGII , OVR , PPAR-γ и VLDLR ), а также BCL2 в фолликулах, показала значительное увеличение после лечения Met (рис. )).

4. Обсуждение

Самым большим признаком дегенерации яичников у млекопитающих является заметное увеличение количества AF [41]. Это явление похоже на домашнюю птицу [42]. Атрезия фолликулов может возникать на любой стадии развития фолликулов и в основном вызывается апоптозом половых клеток или соматических клеток [6]. В птицеводстве увеличение количества АФ напрямую снижает яйценоскость [4]. Уменьшение количества AF обязательно увеличивает шансы развития фолликулов в иерархические фолликулы, тем самым повышая яйценоскость [7].Экспрессия генов или белков, связанных с отложением желтка и апоптозом, среди D280-SWF, D580-SWF и ASWF (D580) сравнивается, и результаты показывают, что способность отложения желтка снижается в ASWF, что согласуется с предыдущим исследованием [ 43].

В период дегенерации фолликулов решающую роль сыграли и другие элементы. ФСГ может индуцировать дифференцировку фолликулярных ГК и увеличивать образование рецептора лютеотропного гормона, а затем стимулировать высвобождение стероидов из ГК, в конечном итоге ограничивая апоптоз и атрезию фолликулов [44].Помимо ФСГ, E 2 также играет важную роль в подавлении атрезии фолликулов. Это исследование показало, что экспрессия FSHR и ER- α снижается в ASWF, что аналогично предыдущим сообщениям [12, 45]. Основываясь на предыдущих исследованиях [3, 7, 46], модель атретического фолликула оценивалась по трем аспектам (способность отложения желтка, апоптоз и выработка рецепторов гормонов). После обработки 1 мМ H 2 O 2 экспрессия FSHR, ER- α , PPAR- γ , VLDLR и окклюдина в SWF была аналогична экспрессии в ASWF.Эти результаты показывают, что модель была успешно установлена.

Что касается апоптоза GC, экспрессия GRP78 (одного из маркеров ER-стресса) будет увеличиваться, когда GCs кур D580 подвергаются апоптозу [7]. Результаты настоящего исследования показали, что экспрессия GRP78, CHOP и каспазы9 была увеличена в ASWF. В то же время ПЭМ-изображения продемонстрировали, что грубый ER и митохондрия в D580-ASWF-GC проявляют дегенерацию. Эти результаты предполагают, что ER-стресс и пути апоптоза митохондрий участвуют в атрезии фолликулов.Между тем, дисбаланс ионов кальция в ER можно рассматривать как основную причину индукции ER-стресса [13]. Следовательно, было важно регулировать концентрацию Ca 2+ в ER. MAM является функциональным доменом в обеих органеллах (ER и митохондрии), который участвует в обмене Ca 2+ [14]. GRP75 является важной частью MAM, и сообщалось, что нокдаун GRP75 снижает способность ER переносить Ca 2+ в митохондрии [19]. Более того, MFN2, который участвует в формировании интегральной функциональной единицы МАМ, снижает высвобождение Cyt c и ингибирует путь апоптоза митохондрий [47, 48].В то же время гомодимер BAX семейства Bcl2 существовал на поверхности митохондрий, а нефосфорилированный BAD (нижестоящий транскрипционный фактор ATK) индуцировал неагрегацию BAX и дополнительно снижал мембранный потенциал митохондрий за счет увеличения уровня кальция в митохондриях (перегрузка кальцием). Эти изменения в конечном итоге привели к высвобождению Cyt c и в конечном итоге активировали каспазу и индуцировали апоптоз митохондрий [20, 21]. Это соединение кальциевого сигнального пути с PI3K / AKT.

Met положительно влияет на борьбу со старением. Например, он уменьшал потерю фолликулов у старых мышей и уменьшал окислительный стресс яичников [31, 32]. Кроме того, было показано, что Met значительно снижает клеточный апоптоз при AF [49]. После обработки Met экспрессия IP 3 R, caspase3 и Cyt c была значительно снижена, в то время как экспрессия MFN2 и GRP75 увеличилась. Это указывает на то, что Met может ингибировать путь апоптоза митохондрий за счет снижения экспрессии Cyt c и подавления каспазы 3, которая играет жизненно важную роль в апоптозе GC [13].Эта функция в основном выигрывает от уравновешивания концентрации Ca 2+ между ER и митохондрией. Выживание GC обеспечивает мотивацию развития PHF, поскольку они секретируют жизненно важные поддерживающие элементы [7, 50–52]. Однако все еще оставалось неясным, может ли Met ингибировать апоптоз путем восстановления функции MAM; может потребоваться более глубокое изучение трехмерной морфологии ER и митохондрий. В другом аспекте наше исследование показало, что экспрессия PI3K и p-AKT / AKT была значительно снижена, в то время как p-GSK-3 β / GSK-3 β была увеличена в модели фолликулярной атрезии, которая была вызвана по H 2 O 2 .В этой модели антиоксидантная способность была снижена в ASWFs [53, 54]. Этот результат соответствовал индуцированному H 2 O 2 окислительному стрессу [55]. Более того, количество PI3K-положительных клеток в GL увеличивалось в группе, получавшей Met, с ограничением экспрессии BAD. Согласованный результат показал, что инактивация PI3K / AKT индуцировала апоптоз GC [8]. Кроме того, после лечения тазелисибом (ингибитор PI3K) Met также может в некоторой степени активировать PI3K, тем самым поддерживая активность сигнального пути PI3K / AKT.

Met также играет важную роль в регулировании образования / отложения желтка. После одной недели непрерывного перорального введения Met уровень сывороточного E 2 и ER- α в печени значительно увеличился, как и в предыдущих сообщениях [56]. Однако предшественники яичного желтка в плазме (HDL, FFA и TG) имели значительные изменения, за исключением LDL и Tchol. Эксперимент in vitro показал, что Met стимулировал экспрессию VLDLR и PPAR-γ , в то время как он ингибировал экспрессию окклюдина и увеличивал способность отложения желтка.Более того, сообщалось, что VLDLR, которые существуют на поверхности мигрирующих нейробластов, могут активировать PI3K / AKT через p-Dab1 [25]. В этом исследовании мы обнаружили, что тенденция экспрессии VLDLR и PI3K / AKT сходна, и мы предположили, что Met может активировать PI3K посредством регуляции экспрессии VLDLR. Кроме того, было показано, что Met стимулирует метаболизм липидов и снижает уровень триглицеридов в крови [57, 58]. Объединив результаты этого эксперимента, предполагалось, что Met увеличивает способность образования желтка и ускоряет транзит предшественника яичного желтка из плазмы в фолликулы яичников.Участвует ли это ускорение в ускоренном отложении желтка и метаболизме липидов, требует дальнейшего изучения. Основываясь на этих аргументах, Met эффективно подавляет атрезию фолликулов, регулируя взаимодействие нескольких сигнальных путей (рис. 10).


5. Заключение

В этом исследовании была создана модель фолликулярной атрезии для изучения механизма Met в ингибировании фолликулярной атрезии у кур. Met был способен подавлять экспрессию BAD и уменьшать апоптоз за счет активации PI3K.Между тем, Met может вмешиваться в связь ER-митохондрии, ослабляя ER-стресс и пути апоптоза митохондрий, чтобы предотвратить апоптоз и атрезию фолликулов. Met также способствовал образованию желтка в печени и отложению желтка в фолликулах яичников. Таким образом, Met был способен уменьшать старение яичников и атрезию фолликулов за счет координации множественных сигнальных путей. Это исследование может предоставить новую меру для продления периода яйцекладки домашней птицы с помощью диетических добавок Met.

Доступность данных

Никакие данные не использовались для поддержки этого исследования.

Конфликт интересов

Авторы заявляют об отсутствии конфликта интересов. Благодарности Это исследование было поддержано Национальным фондом естественных наук Китая (№№ 31972635, 31772693 и 31472160)

Дополнительные материалы

Дополнительный рисунок 1: морфологическое сравнение между ASWF и SWF (A) и изменения в скорости яйцекладки после введения Met (В). (Дополнительные материалы)

Опосредованное состояние минерализации костей у кур-несушек при повышенном содержании кальция во время выращивания и цикла яйцекладки

Абстрактный: Тенденции к снижению возраста половой зрелости и точки яйцекладки без одновременного увеличения содержания кальция в рационе могут снизить потенциал полной минерализации скелета у молодок. Во время яйцекладки повышенная генетическая способность курицы производить больше яиц с меньшим количеством корма без соответствующего увеличения содержания кальция в рационе может еще больше предрасполагать кур к слабости костей, что приводит к проблемам с благополучием и жизнеспособностью.Целями этого исследования было оценить влияние повышенного содержания кальция в кормлении во время выращивания и цикла яйцекладки, а также деформации и плотности на продуктивность кур-несушек и статус минерализации костей. Молодок выращивали до 16 недель в птичнике с 52 молодками / повторность и 28 повторностями / обработку (всего 5824 ч.), Которые затем переводили в птичник с 18-66 недель с 24 или 36 куриц / повторность (в 48 или 64 кв. Дюйма), так что всего было 26 повторов на обработку (всего 5728 кур).Факторная схема обработок 2 x 2 во время выращивания включала линии Leghorns: Hy-Line W-36 (H) и Babcock B-300 (B) и соотношения Ca: P: повышенные (RC +) Ca: P 2,14, 3,14, 4,14 и контроль (RC) Ca: P Соотношение стартера (0-6 недель), производителя (6-12 недель) и проявителя (12-17 недель) соответственно 2,14, 2,14, 2,42. В цикле яйцекладки факторный коэффициент 2 x 2 x 2 x 2 состоял из штаммов, рациона выращивания, режимов рациона несушек: повышение Ca и P (LC +) и постоянное (LC), а также плотности клетки: низкая, 64 дюйм2 / птицу (LD) и высокий, 48 дюйм2 / птицу (HD).Все диеты были изокалорийными и скармливались ad libitum. Потребление корма (FC) и BW контролировали раз в две недели (по периодам), начиная с 2-недельного возраста во время выращивания и каждые 4 недели во время фазы несушки. Смертность и яйценоскость регистрировали ежедневно. Во время выращивания 5 бедренных костей / голени и во время яйцекладки, 3 бедренной кости / голени были измерены на массу кости после извлечения сухого жира (DFEW),% золы, объем и прочность на разрыв кости (BBS) с 6 по 16 неделю и с 51 недели 61 соответственно. С 0-17 недели FC был выше (Pà ⠀ ° ¤0.01) при кормлении RC + (5,11 кг), чем RC (4,81 кг), в противном случае не было никакого влияния на Gain (1017 и 1029 г, соответственно, P = 0,53) или FE (0,199 и 0,214, соответственно, P = 0,08). Напряжение не влияло на FC, Gain или FE. Смертность увеличивалась (PÃ≤0,03) на период в группе B по сравнению со штаммом H. На продуктивность несушки не влияло повышенное содержание кальция во время выращивания или яйцекладки. Влияние штамма (Pà 0,05) на потребление корма, эффективность корма, яйценоскость и смертность. Повышение количества Ca во время выращивания увеличивало DFEW (RC + = 0.94 г по сравнению с RC = 0,82 г, P = 0,04), в то время как деформация влияла на объем кости (H = 2,99 и B = 2,37 куб.см, Pà ¢ °0,01) и бедренный BBS (B = 8,55 против H = 7,80 кг. , P = 0,01) молодок. Кормление большего количества кальция во время яйцекладки не повлияло на состояние костей, но его кормление во время выращивания увеличило BBS (RC + = 14,15 против RC = 12,37 кг, Pà ⠀ ° ¤0,01) у более старых несушек. Воздействие деформации (Pà à 0,001) как BBS (H = 14,26 против B = 12,26 кг), так и объема (H = 5,90 против B = 6,27 куб. См). Эти результаты показывают, что кормление повышенным содержанием кальция во время выращивания и откладки влияет на минерализацию костей и может быть полезной стратегией для уменьшения слабости костей и таких связанных состояний, как остеопороз клеточного слоя.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *